PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_013679-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 263aa    MW: 29665.4 Da    PI: 9.251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_013679-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73.2e-092269348
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                     +W++eE +++ +a + +  +   +W++Ia +++ g++  +++  +q +l
  AHYPO_013679-RA 22 NWSKEENKQFEKALAIFDDNtpdRWSRIAGMIP-GKSVRDVIKQYQELL 69
                     8*****************99*************.***********9875 PP

2Myb_DNA-binding445e-14126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+++++ + +++G+g+W+ I+r++  ++t+ q+ s+ qky
  AHYPO_013679-RA 126 PWTQDEHKRFLLGLQKHGKGDWRNISRYFVITKTPTQVASHAQKY 170
                      8*****************************889***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-51770IPR009057Homeodomain-like
PROSITE profilePS512938.3811873IPR017884SANT domain
SMARTSM007176.7E-111971IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-112176IPR009057Homeodomain-like
CDDcd001671.87E-82269No hitNo description
PfamPF002493.2E-72269IPR001005SANT/Myb domain
PROSITE profilePS5129417.043119175IPR017930Myb domain
SuperFamilySSF466896.36E-17120175IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-17122174IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.7E-10123169IPR009057Homeodomain-like
SMARTSM007176.7E-11123173IPR001005SANT/Myb domain
PfamPF002492.4E-12126170IPR001005SANT/Myb domain
CDDcd001672.74E-9126171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGAIYPNSNY NWLFPGDLKS TNWSKEENKQ FEKALAIFDD NTPDRWSRIA GMIPGKSVRD  60
VIKQYQELLE DVSDIEAGLV PIPGYNLVSS SPFTLEWVDN TRFDPLRKRS SAMVRPFEQE  120
RKKGVPWTQD EHKRFLLGLQ KHGKGDWRNI SRYFVITKTP TQVASHAQKY FLRQNSGGKD  180
KRRPSIHDIT TANLSDNTIP TISETNCASF PLLEKSINIT PKMLVDWSNS NGEALMVINP  240
SHGSQNLYST VCQGASAYVG SH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-17231091193RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690085.11e-151PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-89DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0J8CWZ61e-151A0A0J8CWZ6_BETVU; Uncharacterized protein
STRINGVIT_13s0019g03370.t013e-97(Vitis vinifera)
STRINGGLYMA02G39000.14e-97(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-83MYB family protein